PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G04970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 380aa    MW: 41676.2 Da    PI: 8.5645
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G04970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.91.9e-072482811750
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      A+rsR RK+++i+eLe++v++L++e  +   e++
  LPERR12G04970.1 248 AQRSRVRKLQYIAELERRVQSLQTEGVEVSAEMD 281
                      89*********************99877776666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-6237296IPR004827Basic-leucine zipper domain
CDDcd147036.94E-16238288No hitNo description
SuperFamilySSF579596.19E-6247290No hitNo description
Gene3DG3DSA:1.20.5.1705.4E-7248302No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MMANARFQKQ ALLPPRSPFP AAASPSPSPH GELGPIARPR DGGPHRHGHH QRTSSESVLI  60
DEQPSWLDDL LDEPEAAAAP AARPHGRPGH RRSSSDSFTL FDGGNSAAAA AMYDNVFDGM  120
RGGGGGGGGH GQQVGGSWGG APEFFPEPSS FGRPQGGHGR PWDNRQMLRH GGGAGMPMPM  180
PMREMNGGHR GPPGAFGDLE HGSLPNGVDR KVIGDIHDQR VGAERKEGAH LRHSQSEADT  240
KRAKQQYAQR SRVRKLQYIA ELERRVQSLQ TEGVEVSAEM DFLGQQNIML DLENKALKQR  300
LESLSQEHLI KRFQQEMFER EIGRLRSLFQ QQQQQQHMPQ QQGPTHSRSN SRDLDSQFAN  360
MSLKHSDPNS GCDAVPGLRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618309.10.0PREDICTED: uncharacterized protein At4g06598
TrEMBLA0A0D9XXN60.0A0A0D9XXN6_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9XXN70.0A0A0D9XXN7_9ORYZ; Uncharacterized protein
STRINGORGLA12G0053300.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-45bZIP family protein